PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG077000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 246aa    MW: 26731.7 Da    PI: 4.8165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG077000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.6e-152572148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l   ++ +G  tW+++a+  g++R++k+c++rw +yl
  Pavir.5NG077000.1.p 25 KGLWSPEEDERLFIQITYHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 72
                         678*******************************************97 PP

2Myb_DNA-binding44.73.2e-1480121346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          + ++ E+e+++ + +  G++ W+tIa+tm+ gRt++++k++w++
  Pavir.5NG077000.1.p  80 PISKREEEIIISLQQSIGNR-WSTIAATMP-GRTDNEIKNYWNS 121
                          56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1662076IPR017930Myb domain
SMARTSM007175.7E-92474IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-2724119IPR009057Homeodomain-like
PfamPF002491.7E-122572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-202679IPR009057Homeodomain-like
CDDcd001678.26E-82872No hitNo description
PROSITE profilePS5129415.90577127IPR017930Myb domain
SMARTSM007175.1E-1177125IPR001005SANT/Myb domain
PfamPF002491.1E-1080121IPR001005SANT/Myb domain
CDDcd001673.83E-880120No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2380127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVRKPSHGDT TSAGNGGTEA MKERKGLWSP EEDERLFIQI TYHGVSTWSS VAQLAGLRRS  60
GKSCRLRWMN YLRPDLKKEP ISKREEEIII SLQQSIGNRW STIAATMPGR TDNEIKNYWN  120
SRIRKRLNAA AKAGRDDGAS TKPAPASEEK LEVEATNNAD TEAGPVPIPE RFPVFACQLI  180
DGGIAGGGGS GENTPSTTSS TQQNSGEESE ASVGDSNMIH FISFDDLDYP ADLLMDLPGA  240
MDAWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-252512727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715591e-145EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.11e-135PREDICTED: transcription factor MYB82-like
TrEMBLK3XL221e-135K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-42myb domain protein 50